PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009334
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family G2-like
Protein Properties Length: 306aa    MW: 34355.7 Da    PI: 8.0664
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009334genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like955.9e-30190245156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+peLH+ Fv+++e+LGG+++AtPk+i++ m+v+gLt+++vkSHLQkYRl+
  Lus10009334 190 KQRRCWAPELHRLFVDVLEELGGPHVATPKQIRDKMQVEGLTNDEVKSHLQKYRLH 245
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.151187247IPR017930Myb domain
SuperFamilySSF466891.47E-14188248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.5E-26188248IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-24190245IPR006447Myb domain, plants
PfamPF002492.0E-6192243IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MELSLDLGPV FVPKTVDQCL KEVSKLKDSN QKLSKLDDFV NRLEDERRKI DGFRRELPLC  60
FLLLTDAILK LKEEALAVKR NCCGEDDAEG KKKKKSWMES VQLWRNGDST SKSEQKQRSD  120
EEDNRSTCEN PIKKGSNGVR KEEEKEVVSQ ATELSLMTPF AAATQQVKVF HESINNNKPR  180
LGLGQQFNKK QRRCWAPELH RLFVDVLEEL GGPHVATPKQ IRDKMQVEGL TNDEVKSHLQ  240
KYRLHIRKHS TSPTSQAKYG GNCNETSNDV NLLQSSSPQG PLVGSNDGIS ESHDSSNGAI  300
EKANV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAPTransfer from AT4G37180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079174.11e-91PREDICTED: uncharacterized protein LOC105639663 isoform X1
RefseqXP_012079175.17e-92PREDICTED: uncharacterized protein LOC105639663 isoform X2
TrEMBLA0A067KHZ01e-91A0A067KHZ0_JATCU; Uncharacterized protein
STRINGPOPTR_0007s11470.13e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.15e-66G2-like family protein